LL-37 5mg Peptide
$31.46
$45.61
LL-37 5mg – High-Purity Antimicrobial Research PeptideLL-37 (also known as CAP-18) is a synthetic antimicrobial peptide belonging to the cathelicidin family, widely studied in preclinical research for its immune-modulating, antibacterial, antiviral, and tissue-repair properties. Supplied in lyophilised (freeze-dried) form for maximum stability, this compound is verified at >99.1% purity (HPLC-tested) and includes a full Certificate of Analysis (COA).What is LL-37?LL-37 is a naturally occurring peptide fragment derived from the human cathelicidin antimicrobial protein (hCAP-18). Researchers have investigated LL-37 for its role in innate immunity, inflammation regulation, and cellular regeneration.Bluewell Peptides supplies LL-37 strictly for laboratory research use only, ensuring each batch is tested and verified for purity, stability, and composition transparency.Scientific IdentifiersProduct Name: LL-37 5mgCatalogue Number: BWP-LL37-5CAS Number: 154947-66-7Molecular Formula: C₂₀₃H₃₄₅N₆₁O₄₉SMolecular Weight: 4493.34 g/molSequence: LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTESForm: Lyophilised SolidPurity: >99.1% (HPLC Verified)Storage: Store at −20°C, protected from lightUnit Size: 5mgUsage and ReconstitutionLL-37 is supplied as a lyophilised solid for stability during storage and transport. For laboratory use, it may be reconstituted with bacteriostatic water or other appropriate solvents under aseptic conditions. Refer to our peptide reconstitution page for full guidance.Why Order LL-37 from Bluewell Peptides?99.1% purity, HPLC-verifiedCOA provided with every batchSecure ordering and fast UK deliveryTransparent, research-focused supplierExcellent customer support and trusted reviewsLegal and Safety InformationBluewell Peptides products are supplied strictly for laboratory research and educational purposes only. They are not approved for human or veterinary use. These compounds are not intended to diagnose, treat, cure, or prevent any disease. Use must comply with all applicable laws and regulations.
All Peptides